Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (also known as Potassium voltage-gated channel subfamily A member 2, Voltage-gated K(+) channel HuKIV or HBK5, Kcna2, NGK1, RAK, RBK2, RCK5 and MK2, accession number P16389), epitope mapped to within underlined sequence (amino acids 463-480).
Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
