Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), Biotinylated

Basic informations

  • Size: 20ul
  • Catalog number: PAA537Hu02-20ul-Biotin
  • Price: 212.00EUR
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), Biotinylated

Description

A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Biotin.

Specifications

Host: Rabbit; Species Reactivity: Human, Mouse; Clonality: polyclonal; Tested applications: WB, IHC; Concentration: 500ug/ml; Isotype: IgG; Conjugation: Biotin

Additional_information

Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT); Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.

Storage_and_shipping

Upon receipt, store at -20°C or -80°C. Prepare working aliqotes prior to storage to avoid repeated freeze-thaw cycles.

Notes

Research Use Only.

Properties

If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Test

Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.

Latin name

Mus musculus

Group

Polyclonals and antibodies

About

Polyclonals can be used for Western blot, immunohistochemistry on frozen slices or parrafin fixed tissues. The advantage is that there are more epitopes available in a polyclonal antiserum to detect the proteins than in monoclonal sera.

French translation

anticorps