Mouse monoclonal-Anti- Enolase, Neuron Specific (NSE)-2X20ug

Basic informations

  • Size: 2X20ug
  • Catalog number: MAA537Hu22-2X20ug
  • Price: 330.00EUR
Mouse monoclonal-Anti- Enolase, Neuron Specific (NSE)-2X20ug

Organism Species

Homo sapiens (Human)

Source

Monoclonal antibody preparation

Purification

Protein A + Protein G affinity chromatography

Buffer Formulation

PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.

Item Name

Enolase, Neuron Specific

Immunogen

RPA537Hu02-Recombinant Enolase, Neuron Specific (NSE)

Image number

6

Species reactivity

Human,Mouse

Sequence of immunogen

Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT

Aplication

WB,IHC

Clonality

Mouse monoclonal

Concentration

1mg/ml

Alternative Names

ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase

Applicable Secondary Antibody

SAA544Mu08, SAA544Mu09, SAA544Mu07, SAA544Mu19, SAA544Mu18, SAA544Mu17

Delivery condition

4℃ with ice bags

Storage instructions

Avoid repeated freeze/thaw cycles. Store at 4 ℃ for frequent use. Aliquot and store at -20℃ for 12 months.

Description

This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.Antibody for research use.

About

Monoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.

Test

Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.

Latin name

Mus musculus