Homo sapiens (Human)
Monoclonal antibody preparation
Protein A + Protein G affinity chromatography
PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Enolase, Neuron Specific
RPA537Hu02-Recombinant Enolase, Neuron Specific (NSE)
6
Human,Mouse
Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
WB,IHC
Mouse monoclonal
1mg/ml
ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase
SAA544Mu08, SAA544Mu09, SAA544Mu07, SAA544Mu19, SAA544Mu18, SAA544Mu17
4℃ with ice bags
Avoid repeated freeze/thaw cycles. Store at 4 ℃ for frequent use. Aliquot and store at -20℃ for 12 months.
This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.Antibody for research use.
Monoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Mus musculus