Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), Cy3

Basic informations

  • Size: 200ul
  • Catalog number: MAA537Hu22-200ul-Cy3
  • Price: 483.00EUR
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), Cy3

Description

A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Cy3.

Specifications

Host: Mouse; Species Reactivity: Human, Mouse; Clonality: monoclonal; Tested applications: WB, IHC; Concentration: 1mg/mL; Isotype: IgG2b Kappa; Conjugation: Cy3

Additional_information

Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT; Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.

Storage_and_shipping

Upon receipt, store at -20°C or -80°C. Prepare working aliqotes prior to storage to avoid repeated freeze-thaw cycles.

Notes

Research Use Only.

Properties

If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.Cy3 antibodies are excited by the 488-nanometer wave of an argon laser and the 633-nanometer line of a helium-neon diode laser. 1 of the Enolase, Neuron Specific (NSE) Monoclonal Antibody ( Mouse) can be used in flow cytometry but typically shows lower fluorescence intensity comparable to that of PE or APC. This Cloud Clone Corp antibody is well suited for fluorescent microscopy.Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Conjugation

cy3 conjugation kit

About

Monoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.

Test

Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.

Latin name

Mus musculus

French translation

anticorps