Antibody
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Antigen affinity purified
Unconjugated
Polyclonal antibody
NPY Neuropeptide Y
Rabbit (Oryctolagus cuniculus)
Polyclonal (rabbit origin)
Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
IHC-P
IHC (Paraffin): 0.5-1ug/ml
The stated application concentrations are suggested starting amounts. Titration of the NPY antibody may be required due to differences in protocols and secondary/substrate sensitivity.
This NPY antibodyis to be used only for research purposes and not for diagnostics..
4852
Antigen affinity
Neuropeptide Y is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. Neuropeptide Y also exhibits antimicrobial activity against bacteria and fungi.
An amino acid sequence from the middle region of human Neuropeptide Y (YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY) was used as the immunogen for this NPY antibody (100% homologous in human, mouse and rat).
After reconstitution, the NPY antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
Cytoplasmic & secreted
If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
anticorps