Recombinant Human Kallikrein 8/Neuropsin (C-6His)

Basic informations

  • Size: 500 ug
  • Catalog number: C367-500
  • Price: 1614.00EUR
Recombinant Human Kallikrein 8/Neuropsin (C-6His)

Description

Recombinant Human Kallikrein 8 is produced by our Mammalian expression system and the target gene encoding Gln29-GLy260 is expressed with a 6His tag at the C-terminus.

Species reactivity

Human

Origin

Human cells

Peptide sequence

QEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKGVDHHHHHH

Estimated molecular weight

26,04 kDa

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Shipping condition

Dry Ice/ice packs

Package form

Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Storage conditions

Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Reconstitution conditions

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

UniProt number

O60259

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Source

Recombinants or rec. proteins

Group

recombinants