Description
Recombinant Human Neuronal Pentraxin-1 is produced by our Mammalian expression system and the target gene encoding Gln23-Asn432 is expressed with a 6His tag at the C-terminus.
Species reactivity
Human
Origin
Human cells
Peptide sequence
QDFGPTRFICTSVPVDADMCAASVAAGGAEELRSSVLQLRETVLQQKETILSQKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSATPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGATKWTFEACRQINHHHHHH
Estimated molecular weight
45,9 kDa
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition
Ambient/Room Temperature
Package form
Lyophilized from a 0.2 µm filtered solution of PBS,1mM EDTA,PH7.4.
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Reconstitution conditions
See included datasheet or contact us for more information.
UniProt number
Q15818
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source
Recombinants or rec. proteins
Group
recombinants