Recombinant Mouse NBL1 is produced by our Mammalian expression system and the target gene encoding Ala17-Asp178 is expressed with a 6His tag at the C-terminus.
Mouse
Human cells
APPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKIVHCSCQACGKEPSHEGLNVYVQGEDSPGSQPGPHSHAHPHPGGQTPEPEEPPGAPQVEEEGAEDVDHHHHHH
18,4 kDa
Greater than 95% as determined by reducing SDS-PAGE.
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Ambient/Room Temperature
Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Q61477
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Mus musculus
Recombinants or rec. proteins
recombinants
Kinase, breast cancer tumor, HRAS like - suppressor protein make genetic suppression restoring the phenotype seen prior to the original background in biological pathways.