Recombinant Human Brain-Derived Neurotrophic Factor/BDNF

Basic informations

  • Size: 10 ug
  • Catalog number: C076-10
  • Price: 203.00EUR
Recombinant Human Brain-Derived Neurotrophic Factor/BDNF

Description

Recombinant Human Brain-Derived Neurotrophic Factor is produced by our E.coli expression system and the target gene encoding His129-Arg247 is expressed.

Species reactivity

Human

Origin

Escherichia coli

Peptide sequence

MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Estimated molecular weight

27 kDa

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Shipping condition

Ambient/Room Temperature

Package form

Lyophilized from a 0.2 µm filtered solution of 20mM PB, 250mM NaCl, pH 7.2.

Storage conditions

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Reconstitution conditions

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

UniProt number

P23560

Tissue

brain

Additional description

Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Source

Recombinants or rec. proteins

Group

recombinants