A synthetic peptide corresponding to a sequence at the C-terminus of human Neuroserpin (272-310aa KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
Storage condtions
Keep the Neuroserpin Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
Tips
The Neuroserpin Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
Background
Neuroserpin is a protein that in humans is encoded by the SERPINI1 gene. This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Related articles
1. "Entrez Gene: SERPINI1 serpin peptidase inhibitor, clade I (neuroserpin), member 1". 2. Yepes M, Lawrence DA (2004). "Neuroserpin: a selective inhibitor of tissue-type plasminogen activator in the central nervous system.". Thromb. Haemost. 91 (3): 457–64.
Gene Name
SERPINI1
Protein Name
Neuroserpin
Gene Full Name
serpin peptidase inhibitor, clade I (neuroserpin), member 1
Synonyms
DKFZp781N13156 antibody|Neuroserpin antibody|NEUS_HUMAN antibody|Peptidase inhibitor 12 antibody|PI-12 antibody|PI12 antibody|Protease inhibitor 12 antibody|Serine or cysteine proteinase inhibitor clade I (neuroserpin) member 1 antibody|Serine or cysteine proteinase inhibitor clade I member 1 antibody|Serpin I1 antibody|Serpin peptidase inhibitor clade I (neuroserpin) member 1 antibody|SERPINI1 antibody
Uniprot ID
Q99574
Entrez GeneID
5274
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
