Neuroplastin antibodies were raised using the middle region of NPTN corresponding to a region with amino acids MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN
Raised in
Rabbit
Specificity
Neuroplastin antibody was raised against the middle region of NPTN
Cross Reactivity
Human,Mouse,Rat,Dog
Method of Purification
Total IgG Protein A purified
Concentration
1 mg/ml
Form & Buffer
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NPTN antibody in PBS
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping conditions
Blue Ice
Tested for
WB; IHC
Usage Recommendations
WB: 5 ug/ml; IHC: 4-8 ug/ml
Assay Information
Neuroplastin Blocking Peptide, catalog no. 33R-5985, is also available for use as a blocking control in assays to test for specificity of this Neuroplastin antibody
Additional Information
This is a rabbit polyclonal antibody against NPTN. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
Properties
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
