Neuropilin antibody

Basic informations

  • Size: 50 µg
  • Catalog number: 70R-7286
  • Price: 475.00EUR
Neuropilin antibody

Category

Primary Antibody

Antibody Subtype

Polyclonal Antibodies, Purified

Area of research

Signal Transduction

Type of Immunogen

Neuropilin antibodies were raised using the N terminal of NETO2 corresponding to a region with amino acids GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE

Raised in

Rabbit

Specificity

Neuropilin antibody was raised against the N terminal of NETO2

Cross Reactivity

Human,Mouse

Method of Purification

Affinity purified

Concentration

1 mg/ml

Form & Buffer

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NETO2 antibody in PBS

Storage

Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Shipping conditions

Blue Ice

Tested for

WB

Usage Recommendations

WB: 1 ug/ml

Assay Information

Neuropilin Blocking Peptide, catalog no. 33R-3329, is also available for use as a blocking control in assays to test for specificity of this Neuropilin antibody

Additional Information

This is a rabbit polyclonal antibody against NETO2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]

Properties

If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

French translation

anticorps