WB
Primary Antibodies
Purified Polyclonal Antibodies
Signal Transduction
Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids SAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRK
Neuroplastin antibody was raised against the middle region of NPTN
Human,Mouse,Rat
NA
1 mg/ml
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NPTN antibody in PBS
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Blue Ice
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
Oryctolagus cuniculus
anticorps