Homo sapiens (Human)
Monoclonal antibody preparation
Protein A + Protein G affinity chromatography
PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Enolase, Neuron Specific
RPA537Hu02-Recombinant Enolase, Neuron Specific (NSE)
6
Human,Mouse
Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
WB,IHC
Mouse-monoclonal
1mg/ml
ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase
SAA544Mu08, SAA544Mu09, SAA544Mu07, SAA544Mu19, SAA544Mu18, SAA544Mu17
4℃ with ice bags
Avoid repeated freeze/thaw cycles. Store at 4 ℃ for frequent use. Aliquot and store at -20℃ for 12 months.
This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.Antibody for research use.
If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Monoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.
anticorps