Homo sapiens (Human)
Polyclonal antibody preparation
Antigen-specific affinity chromatography followed by Protein A affinity chromatography
0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Enolase, Neuron Specific
RPA537Hu02-Recombinant Enolase, Neuron Specific (NSE)
4
Human,Mouse
NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
WB,IHC
Rabbit-polyclonal
500ug/ml
ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase
SAA544Rb59, SAA544Rb58, SAA544Rb57, SAA544Rb18, SAA544Rb19
-
4℃ with ice bags
Avoid repeated freeze/thaw cycles. Store at 4 ℃ for frequent use. Aliquot and store at -20℃ for 12 months.
This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Polyclonals and antibodies
Polyclonals can be used for Western blot, immunohistochemistry on frozen slices or parrafin fixed tissues. The advantage is that there are more epitopes available in a polyclonal antiserum to detect the proteins than in monoclonal sera.
anticorps