Homo sapiens (Human)
Polyclonal antibody preparation
Antigen-specific affinity chromatography followed by Protein A affinity chromatography
0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Enolase, Neuron Specific
RPA537Hu02-Recombinant Enolase, Neuron Specific (NSE)
4
Human,Mouse
NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
WB,IHC
Rabbit polyclonal
500ug/ml
ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase
SAA544Rb59, SAA544Rb58, SAA544Rb57, SAA544Rb18, SAA544Rb19
-
4℃ with ice bags
Avoid repeated freeze/thaw cycles. Store at 4 ℃ for frequent use. Aliquot and store at -20℃ for 12 months.
This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.