Homo sapiens (Human)
Polyclonal antibody preparation
Antigen-specific affinity chromatography followed by Protein A affinity chromatography
0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Enolase, Neuron Specific
RPA537Hu02-Recombinant Enolase, Neuron Specific (NSE)
4
Human,Mouse
NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
WB,IHC
Rabbit polyclonal
500ug/ml
ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase
SAA544Rb59, SAA544Rb58, SAA544Rb57, SAA544Rb18, SAA544Rb19
-
4℃ with ice bags
Avoid repeated freeze/thaw cycles. Store at 4 ℃ for frequent use. Aliquot and store at -20℃ for 12 months.
This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
Polyclonals and antibodies
Polyclonals can be used for Western blot, immunohistochemistry on frozen slices or parrafin fixed tissues. The advantage is that there are more epitopes available in a polyclonal antiserum to detect the proteins than in monoclonal sera.Rabbits are used for polyclonal antibody production by Cloud Clone Corp. Rabbit antibodies are very stable and can be stored for several days at room temperature. Cloud Clone Corp adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
Oryctolagus cuniculus