Human, Mouse
6-11 business days
Monoclonal
Ser2-Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
WB, IHC
Unconjugated
1 mg/ml
Enolase, Neuron Specific (NSE) Monoclonal Antibody should be stored at -20°C
Use Enolase, Neuron Specific (NSE) Monoclonal Antibody before 1 year
Ice packs
For research use only. Not for diagnostic procedures.
To order Enolase, Neuron Specific (NSE) Monoclonal Antibody , please use the Cat. Nr. CAU29488 and submit your purchase order by email or by fax. A discount is available for larger or bulk quantities, please contact us for more information
Our specialists recommend you to follow carefully the pre-registered instructions for Enolase, Neuron Specific (NSE) Monoclonal Antibody
If you buy Antibodies supplied by Biomatik they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Monoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.
anticorps