Human, Mouse
6-11 business days
Polyclonal
NSE (Ser2-Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
WB, IHC
Unconjugated
500 ug/ml
Enolase, Neuron Specific (NSE) Polyclonal Antibody should be stored at -20°C
Use Enolase, Neuron Specific (NSE) Polyclonal Antibody before 1 year
Ice packs
For research use only. Not for diagnostic procedures.
To order Enolase, Neuron Specific (NSE) Polyclonal Antibody , please use the Cat. Nr. CAU27731 and submit your purchase order by email or by fax. A discount is available for larger or bulk quantities, please contact us for more information
Our specialists recommend you to follow carefully the pre-registered instructions for Enolase, Neuron Specific (NSE) Polyclonal Antibody
If you buy Antibodies supplied by Biomatik they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Polyclonals and antibodies
Polyclonals can be used for Western blot, immunohistochemistry on frozen slices or parrafin fixed tissues. The advantage is that there are more epitopes available in a polyclonal antiserum to detect the proteins than in monoclonal sera.
anticorps